PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G2392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 231aa    MW: 25829.1 Da    PI: 9.3586
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G2392genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.3e-1359107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48 
                      +g+W++ Ed++l d++ ++G g+W++ ++    + R++k+c++rw +yl
      Gh_A09G2392  59 KGAWSKLEDQKLTDYILKHGEGCWRSLPQAAAgLLRCGKSCRLRWVNYL 107
                      79*********************************************97 PP

2Myb_DNA-binding52.61.1e-16113155145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+
      Gh_A09G2392 113 RGKFGEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNHWN 155
                      89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.4E-2150109IPR009057Homeodomain-like
PROSITE profilePS5129411.53254107IPR017930Myb domain
SuperFamilySSF466891.84E-2657154IPR009057Homeodomain-like
SMARTSM007172.8E-1058109IPR001005SANT/Myb domain
PfamPF002491.1E-1159107IPR001005SANT/Myb domain
CDDcd001673.11E-861107No hitNo description
PROSITE profilePS5129427.064108162IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-24110162IPR009057Homeodomain-like
SMARTSM007171.5E-15112160IPR001005SANT/Myb domain
PfamPF002492.9E-15113155IPR001005SANT/Myb domain
CDDcd001673.20E-11115158No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MAAGDKHKPL FIYIYILLVS LFISPPLPLF WSVAFACLNS LPLGLQMRKP CCEKKDTNKG  60
AWSKLEDQKL TDYILKHGEG CWRSLPQAAA GLLRCGKSCR LRWVNYLRPD LKRGKFGEDE  120
EDLIIKLHAL LGNRWSLIAG RLPGRTDNEV KNHWNIHLKK KLLMMGIDPN NRRSLLSPTL  180
TKSNASNDSS SACQPFNPAT ASEAISCTCL PDLNLDLTIA PPLSHQNLAL N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28561624108B-MYB
1h8a_C9e-285816226128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591653e-70AJ459165.1 Gossypium hirsutum partial myb135 gene, clone pGhMYB135.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012486405.11e-145PREDICTED: myb-related protein 308-like
SwissprotP813936e-73MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0D2S6461e-145A0A0D2S646_G
STRINGPOPTR_0010s12420.13e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.15e-71myb domain protein 3